PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn369371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 325aa    MW: 36387.1 Da    PI: 5.9872
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn369371genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.64.9e-12221250130
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPk 30 
                 k+r+rWt++LH+rFve+v++LGG+e+   k
  Achn369371 221 KTRIRWTQDLHDRFVECVNRLGGPERKSEK 250
                 68**********************986655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-9220251IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-7221264IPR006447Myb domain, plants
PfamPF143796.8E-20261308IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MATQKLSYDF GKQFTRNGGN WNGNGNGNSH FFGTQPQLEN LMGILIPSPN TGREFGSLEK  60
NWDQASSSTT ILSRIGSPIS AFYATEKYMG FPQFDFPSGI GNSDFQTPPY QPPGDRFCFE  120
KPEESGLKSH FSSGQNYGSD HEKSGQVQGN DFLEREKILQ LKRKLLDDFD TSDRNQDVSV  180
NQNLYNSQLE HMRQSGGPSA GGVVSVNSSN SVPSGAALAS KTRIRWTQDL HDRFVECVNR  240
LGGPERKSEK KANMNDATSG MQIKEALQLQ LDVQRQLHEQ LEIQRNLQLR IEEQGRQLRQ  300
MFDQQQNTNK NLFEMESSSL ALSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801945.12e-65PREDICTED: uncharacterized protein LOC104247585
RefseqXP_016456493.12e-65PREDICTED: uncharacterized protein LOC107780454
TrEMBLA0A0B2PVD63e-52A0A0B2PVD6_GLYSO; Myb family transcription factor APL
TrEMBLA0A0R0IG192e-52A0A0R0IG19_SOYBN; Uncharacterized protein
TrEMBLK7LD833e-52K7LD83_SOYBN; Uncharacterized protein
STRINGGLYMA09G17404.19e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-32G2-like family protein